PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011102060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 123aa    MW: 13645.4 Da    PI: 4.4888
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011102060.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26083.82.6e-2637133101
          DUF260  33 vhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                     +h++FGasn++kll++lpe +r da++s+vyeA+ar+rdP+yG++g+i +lq+q+++l+ae+a++++e+
  XP_011102060.1   3 AHRVFGASNIIKLLQELPEAQRADAVNSMVYEANARLRDPIYGCTGMICHLQSQVSELQAEVAKAQAEI 71 
                     8***************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089115.888171IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-25268IPR004883Lateral organ boundaries, LOB
Gene3DG3DSA:1.20.58.601.9E-422121No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
ITAHRVFGAS NIIKLLQELP EAQRADAVNS MVYEANARLR DPIYGCTGMI CHLQSQVSEL  60
QAEVAKAQAE ILNMQCQNAS LIDLLCKGMA GTQNVEENLI YDHNSTIFSD EPNVGVSWEH  120
LWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011102212.11e-88PREDICTED: LOB domain-containing protein 1-like, partial
RefseqXP_011102060.11e-88PREDICTED: LOB domain-containing protein 1-like, partial
SwissprotQ9LQR06e-44LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A022RH943e-56A0A022RH94_ERYGU; Uncharacterized protein
STRINGPOPTR_0010s22470.15e-51(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-45LOB domain-containing protein 1